SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012171 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012171
Domain Number 1 Region: 64-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.36e-82
Family Ankyrin repeat 0.00000797
Further Details:      
 
Domain Number 2 Region: 663-1018
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.78e-61
Family Ankyrin repeat 0.0000127
Further Details:      
 
Domain Number 3 Region: 370-500,529-597
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.14e-43
Family Ankyrin repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012171   Gene: ENSDORG00000012944   Transcript: ENSDORT00000012946
Sequence length 1077
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5830:53917:69936:-1 gene:ENSDORG00000012944 transcript:ENSDORT00000012946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILSITDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXANVNAKDTLWLTPLHRAAASRNEKVLGLLLAHSADVNARDKLWQTPLHVAAANRAT
KCAEALAPLLSSLNVADRSGRSALHHAVHSGHLETVNLLLNKGASLNVCDKKERQPLHWA
AFLGHLEVLKLLVARGADLGCKDRKGYGLLHTAAASGQIEVVKYLLRMGAEIDEPNAFGN
TALHIACYLGQDAVAIELVNAGANVNQPNDKGFTPLHVAAVSTNGALCLELLVNNGADVN
YQVLEGKSPLHMAAIHGRFTRSQILIQNGSEIDCADKFGNTPLHVAARYGHELLISTLMT
NGADTARRGIHDMFPLHLAVLFGFSDCCRKLLSSGQLYSIVSSLSNEHVLSAGFDINTPD
NLGRTCLHAAASGGNVECLNLLLSSGADLRRRDKFGRTPLHYAAANGSYQCAVTLVTAGA
GVNEADCKGCSPLHYAAASDTYRRAEPHTASSHDAEEDEPLKESRRKEAFFCLEFLLDNG
ADPSLRDRQGYTAVHYAAAYGNRQNLELLLEMSFNCLEDVESTIPVSPLHLAAYNGLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XASGHTDSLHLLIDSGERADITDVMDAYGQTPLMLAIMNGHVDCVHLLLEKGSTADAADL
RGRTALHRGAVTGCEDCLAALLDHDAFVLCRDFKGRTPIHLASACGHTAVLRTLLQAALS
TDPLDAGVDYSGYSPMHWASYTGHEDCLELLLEHSPFSYLEGNPFTPLHCAVINNQDSTT
EMLLGALGDKIVNSRDAKGRTPLHAAAFADNVSGLRMLLQHQAEVNATDHTGRTALMTAA
ENGQTAAVEFLLYRGKADLTVLDENKNTALHLACSKGHEKCALMILAETQDLGLINATNS
ALQMPLHIAARNGLASVVQALLSRGATVLAVDEEGHTPALACAPNKDVADCLALILSTMK
PFPPKDAVSPFSFSLLKNCGIAAAKTVGGCGALPHGASCPYSQERHGAIGLDGCYSE
Download sequence
Identical sequences ENSDORP00000012171 ENSDORP00000012171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]