SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012215 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012215
Domain Number 1 Region: 132-191
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012215
Domain Number - Region: 42-112
Classification Level Classification E-value
Superfamily Tropomyosin 0.0157
Family Tropomyosin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012215   Gene: ENSDORG00000012994   Transcript: ENSDORT00000012994
Sequence length 274
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6841:283:11378:1 gene:ENSDORG00000012994 transcript:ENSDORT00000012994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGRDKQMSEEQPPSPPSPQPAAEQSSYLYSTEITLWTVVAAIQALEKKVDSCLARLLTL
EGRTGTAEKKLADCEKTAVEFGNQLEGKWAVLGTPLQEYGLLQRRLENVENLLRNRNFWI
LRLPPGGKGEAPKVPLTFDDVAVYFSEWEWGKLEDWQKELYKHVMRGNYETLVSLDYAIS
KPDILTRIERGEEPCPEDWWGQEKGSEESACSKKSGTGLPPQPQWVLRSDNPTQEEPKDQ
TPVQQRVEEVRRPPPGPGTGMALGTDLHREAQIQ
Download sequence
Identical sequences ENSDORP00000012215 ENSDORP00000012215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]