SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012229 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012229
Domain Number 1 Region: 931-1144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-105
Family Thrombospondin C-terminal domain 0.00000000134
Further Details:      
 
Domain Number 2 Region: 6-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-35
Family Laminin G-like module 0.0000000171
Further Details:      
 
Domain Number 3 Region: 465-522
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.0000172
Further Details:      
 
Domain Number 4 Region: 411-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000183
Family TSP-1 type 1 repeat 0.0000379
Further Details:      
 
Domain Number 5 Region: 292-350
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000045
Family VWC domain 0.0077
Further Details:      
 
Domain Number 6 Region: 739-802
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000034
Family TSP type-3 repeat 0.00038
Further Details:      
 
Domain Number 7 Region: 666-751
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000536
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 8 Region: 355-404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 9 Region: 523-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012229
Domain Number - Region: 907-929
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0301
Family TSP type-3 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012229   Gene: ENSDORG00000013009   Transcript: ENSDORT00000013009
Sequence length 1144
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3151:14108:25081:1 gene:ENSDORG00000013009 transcript:ENSDORT00000013009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGGDGSVFDVLELAGAARRGSGRRLVKGPDPSSPAFRIENADLIPPMPDDKFQDLVDAVR
AEKGFLLLASLRQMKRTRGALLAVERKDRSGPVFAVVSNGKAGTLDLSLDAQGRQQVVSV
EEAFLATGQWRSITLFVQEDRAQLYIDCEKMESVELDVPIQSIFTRDLASTARLRVAKGD
VNDNFGVLQNVRFVFGTTPEDVLRNKGCSSSANVLLTLDNNVVNGSSPAIRTNYIGHKTK
DLQAICGISCDELSSMVLELRSLRTIVTTLQDSIRKVTEENKELANELRRPHFCYHNGVQ
YRNNEEWTVDGCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSP
WSEWTSCSATCGNGVQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPW
SSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETTACRKAACPINGGWGPWSLWDIC
SVTCGGGVQKRSRLCNNPTPQFGGKDCIGDVTESQVCNKQDCPIDGCLSNPCFAGAKCTS
HPDGSWKCGACPAGYTGNGIQCSDVDECKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRF
TGSQPFGRGIEHAMANKQVCSPRNPCKDGTHDCNRNANCNYLGHYSDPMYRCECRPGYAG
NGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDN
DKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDSNGEGDACAADIDGD
GILNERDNCQYVYNVDQRDTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDFDHDNVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGK
ELVQTVNCDPGLAVGYNEFNAVNFIGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVT
QSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKD
FTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLK
YECR
Download sequence
Identical sequences ENSDORP00000012229 ENSDORP00000012229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]