SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012259 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012259
Domain Number 1 Region: 152-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 49-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 107-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012259   Gene: ENSDORG00000013039   Transcript: ENSDORT00000013040
Sequence length 787
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2358:2810:15052:1 gene:ENSDORG00000013039 transcript:ENSDORT00000013040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCTVLSLCGAAAQKQEGCARWCPPNSKCLSADTCRCDAGFSSVEELITSPDGSCDDINEC
APPLRTYCGKFADCENTEGSYYCTCSPGYALESGDKIFRNESENTCQDVNECTSGHHNCH
SSAHCLNKAGGYECRCRRGWRPILGSPEGPTHTQCEDVDECRSGQHQCHSSAVCVNTVGS
YRCRCPPGWRPCRGRPRAQEVVFPTWTAPPGIHSTALAAFLEEVQNLTRDFQPHTARDTA
DAIQNLIKALDGLLEAPGDMERLDLPARHRIATQLLLGMEGTLRSLAQALPAVSFNYTSD
SSTALFLMVQEQQQQPAGNITIGHGQAQMTLSWAVATGNEPSSPTVAGILSSQNMKNWLT
NTSLDLEGRLASLEETYESPVLGVQFRFLSSINSVFLTNTKTGELAYPVTFNFSHRESDE
SAGREPHTLPVPREMPGPRDEVICAFWKGEDGNRSGHWSTEGCRKVGSKDGITICQCRHL
SSFAILMAHYHIQDPRLALITKVGLSLSLVCLLLCILTFLLVRSIQSSRTTVHLHLCLCL
FVGSALFLAGVENNTEGGQVGLRCRLVAALLHYCFLAAFCWMSLEGLELYFLVVRVFRGQ
GLRTRWQCLLGYGVPLLVVAVSAAVYSEGYGRPSYCWLSLKRGFLWSFVGPLAFIILXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVREEYRRWASAVVEGKYSEFGSSHSSSTGSSQQTRA
LRSSSSG
Download sequence
Identical sequences ENSDORP00000012259 ENSDORP00000012259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]