SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012269 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012269
Domain Number 1 Region: 271-364
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-23
Family SPRY domain 0.0016
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 5.08e-19
Family RING finger domain, C3HC4 0.0053
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000412
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012269   Gene: ENSDORG00000013054   Transcript: ENSDORT00000013052
Sequence length 364
Comment pep:novel scaffold:dipOrd1:scaffold_33593:14143:15377:1 gene:ENSDORG00000013054 transcript:ENSDORT00000013052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDTAQAFQKELSCAICMNTFIEPVTLECGHSFCRPCLCLCWEETQTLTRCPGCRGPCQ
QRDLKTNVVLRSLVAIARRASLRQFLSSEEYMCEIHRETKQMFCEVDKALLCRSCSQSQE
HRAHKHHLIERAAEEQREMISKQMHAVWEKTQENQHNLQEKRRMTKDVFRMLQLGVQEEE
RHHQLLINEQRARLLQLRERETQMLQKKHQLRNMYQELIETYQKPDVELLQESVLFFLPL
PLRPELSAPPMPGLIERLSQYRAVLNSEESLHFTAFGHQVFSSGKHYWEVSVDDSCTWAL
GVIRNSAIGSNLTESEDLFLLLFVKENTLYTLFTTSPLLPHYVQKPSRVGVFLDLDHGSV
SFWN
Download sequence
Identical sequences ENSDORP00000012269 ENSDORP00000012269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]