SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012298 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012298
Domain Number 1 Region: 20-205,297-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-62
Family Calnexin/calreticulin 0.00013
Further Details:      
 
Domain Number 2 Region: 227-288
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.00000000000085
Family P-domain of calnexin/calreticulin 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012298   Gene: ENSDORG00000013084   Transcript: ENSDORT00000013084
Sequence length 384
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_31111:4971:14629:1 gene:ENSDORG00000013084 transcript:ENSDORT00000013084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPARVAALCAVCALRVVLATVYFREEFLDGERWRNRWVQSTNDSNCGHFTVSSGKFYGH
KEKDKGLQTTQNGRFYAISARFKPFSSKGKTLVVQYTVKHEQKMDCGGGYVKIFPADLDQ
RNLNARSPYYVMFGPDICGFDIKTVHVILYFKNQYHSNKKHIRCKVDAFTHLYTLVLRPD
LTYEVRIDGQAIESGSVEYDWQLTSLKNVEKAEAQARGPARARGATAQDWEQHFLDASAP
SDWNSELDGDWQAAMLQKPPYQDSLRAEGIDRDVWLHEKMQSASYLLQQDLLEFENIGAI
GLELWQVRSGTIFDNFLITDDEDYAVKFGKATWGETKGPEREMDAIQAKEELKQAREEDE
QEMLSGKFPGRHGHFSQFPRPDGL
Download sequence
Identical sequences ENSDORP00000012298 ENSDORP00000012298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]