SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012335 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012335
Domain Number 1 Region: 3839-3867,3907-4065
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-33
Family Laminin G-like module 0.00089
Further Details:      
 
Domain Number 2 Region: 1632-1648,3652-3832
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-33
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 405-490
Classification Level Classification E-value
Superfamily Immunoglobulin 6.65e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1946-2035
Classification Level Classification E-value
Superfamily Immunoglobulin 8.04e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 3559-3647
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 3482-3569
Classification Level Classification E-value
Superfamily Immunoglobulin 2.86e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 3097-3190
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 1667-1763
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 1761-1848
Classification Level Classification E-value
Superfamily Immunoglobulin 3.87e-17
Family I set domains 0.0000262
Further Details:      
 
Domain Number 10 Region: 3199-3282
Classification Level Classification E-value
Superfamily Immunoglobulin 9.85e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 11 Region: 2424-2515
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-16
Family I set domains 0.032
Further Details:      
 
Domain Number 12 Region: 2526-2611
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 2044-2130
Classification Level Classification E-value
Superfamily Immunoglobulin 3.04e-16
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 14 Region: 3386-3478
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000114
Family I set domains 0.014
Further Details:      
 
Domain Number 15 Region: 2617-2706
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family I set domains 0.033
Further Details:      
 
Domain Number 16 Region: 1855-1943
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000271
Family I set domains 0.036
Further Details:      
 
Domain Number 17 Region: 2719-2807
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000306
Family I set domains 0.041
Further Details:      
 
Domain Number 18 Region: 3011-3105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000999
Family I set domains 0.031
Further Details:      
 
Domain Number 19 Region: 2233-2314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000139
Family I set domains 0.035
Further Details:      
 
Domain Number 20 Region: 2333-2415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000811
Family I set domains 0.076
Further Details:      
 
Domain Number 21 Region: 2143-2223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000887
Family V set domains (antibody variable domain-like) 0.058
Further Details:      
 
Domain Number 22 Region: 2815-2866,2951-2998
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000131
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 
Domain Number 23 Region: 1554-1606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 24 Region: 283-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 322-360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 26 Region: 367-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 27 Region: 757-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 28 Region: 1152-1204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 29 Region: 817-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000398
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 30 Region: 194-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 1613-1661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family Laminin-type module 0.051
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012335
Domain Number - Region: 1212-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 880-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000622
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 1115-1154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00301
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 1519-1556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00367
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 715-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012335   Gene: ENSDORG00000013115   Transcript: ENSDORT00000013121
Sequence length 4066
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3491:331:97091:-1 gene:ENSDORG00000013115 transcript:ENSDORT00000013121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDTETITAGRTGWSYSYLSDDEDLL
ADDASGDGLGSGDLGSGDFQMVYFRALVNFTHSIEYSPQLEDAGSKEFREVSDAVVDKLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEVLHTVVSRGSIGSYVTS
PQGFQFRRLGTVPQVPRVCTEAEFACHSHNECVALEYRCDRRPDCRDMSDELDCEDSVPE
LASLPPSGVETSPPPVWPDTITTLPTPVVPRPQPLFPDSRGLRPCGPQEAMCHSGHCIPK
DYLCDGQEDCKDGSDELDCGPPQPCEPNEFACGNGHCALKLWRCDGDFDCKDQTDEADCP
TKQPEEVCEPTQFRCVSTNLCIPTSFQCDEESDCPDRSDEFGCMPPQVVTPPQESIQVSR
GQTVTFTCVAIGVPTPIINWRLNWGHIPSNSRVTMTSEGGRGTLTIRDVKEADQGAYTCE
AMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEDSASCLPCFCFGVTSMCQSSRRFRDQI
HLRFDRPEDFKGVNVTMPTQPGMPPLSSTQLQIDTVLQEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYKVRYELARGPLEPVQKPDVVLVGAGYRLLSRGHMPTQPGTLNQR
QVQLSEEHWHESGRPVQRAEILQLANLEGVLIIGYMQMSVGLSDIMDTTVTHTTTHHAHS
VEECRCPIGYSGLSCESCDTHFTRVPGGPYLGTCSGCNCNGHASACDPVYGHCLNCQHNT
EGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYT
GRRCESCAPGYEGNPIQPDGKCRPVNQEIVRCDERGSMGTTGEACRCKNNVVGRVCNECA
DGSFHLSSQNPDGCLKCFCMGVSRQCTSSSWSRAQVLGASEEPTQFSLTNAAGTHTTSEG
ISSPTSGELVFSSFHSLLSGPYFWSLPSRFRGDKVTSYGGELHFTVTQRPRPSSAPLHGQ
PLVVLQGNGIVLEHHTSQEPIPGQSSAFTVPFREQAWQRPDGQPATREHLLMALAGIDAL
LIQASYTQQPAESRVSDISMDVAVPENTGQDPALEVEQCTCPSGYRGPSCQDCDTGYTRM
PSGLYLGTCERCSCHGHSEVCEPETGTCQGCQHHTEGPRCDQCQQGYYGDAQRGTPHDCQ
PCPCHGPPSAGQVSHTCFLDTDSHPTCDSCSPGHSGRHCERCTQGYYGNPSQGQPCRRDG
QIPEVTGCDCNPQGSISSQCDAAGQCQCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDGAQLSFGNF
ALGHGFYWQLPELYQGDKVAAYGGKLRYTLSYSAGPQGSPVSDPDIQITGNNIMLVASQP
APQGPERRSYEIIFREEFWHRPDGQPATREHLLMALADLDELLIRATFSSVPRTASISSV
SLEVARPGPSHGPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCECNGHS
DLCHPETGACSQCQHNTAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCE
SLGAGGYRCTACEPGYTGQYCEQCAPGYVGNPNVQGGRCLPEADEAPLVVQVHPTRSVVP
QGGPHSLQCKVTGSPPHYFYWSREDGRPMPSSAQQRHQGSELHFPSVQPSDAGVYICTCR
NLHHTSNSRAELLVSEAPSKPITVTVEEPRSQSVRPGADVTFVCTAKSKSPAYTLVWTRL
HNEKLPSRAMDFNGILTIRNVQPSDAGTYTCTGSNMFAMDLGTATLHVQASGTLSAPVVS
ISPPQLTVQPGQLAEFRCSATGNPPPTLEWSGGPGGQLPQKAQIHGGILRLPAVEPSDQS
QYLCRAHSSAGQHVARALLQVQGGSGPRVQVSPERTQVTEGRTVRLYCRVLGVPSTSITW
RKEGGSLPPQARSEHTDIATLIIPAVTLADAGFYLCVATSPTGTSQARIQVVVLSASGAS
TLPVRIESSSPSVTEGQTLDLNCAVTGLAHTQITWYKRGGSLPPHAQVHGSRLRLPQVSP
ADSGDYVCRVESELGPKEASIVVSVLSTPSGPSHTLATGSTQPIRIESSSSHVAEGQTLD
LNCKVPRQARVTWRKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCHVTLGSEHTETSVL
VTIEPSGSIPGPVPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQV
RGSRLYIFQASPVDAGEYVCRASNGQEASITVTVAGTQGANFAHPPGSTQPLRIEPSSSH
VAEGQTLDLNCVVPGQAHAQVTWQKRGGSLPTRHQTHGSLLRLYQVSPADSGEYVCRVEG
SSTPLETSVLVNIVPADSVPALGVTPTVRIESSSSHVAEGQTLDLNCLVNGQAHAQVTWH
KRGGSLPARHQVLGSRLRLPQVTPADSGEYVCRVASGSGTQEASVLVTIQQRLRPFHTQS
MVYPVRIESSSASLANGHTLDLNCVVASHTPHTITWYKRGGSLPSRHQIVGSRLRIPQVT
PADSGEYVCHVSNGAGSQETSLIVTIQGSGSMHVPSVSPPIRIESSSSTVLKGDTLDLNC
VVAGQTQATITWFKRGGSLPARHQAHGSRLRLHQMSVADSGEYVCRANNNIEAQETSIVV
TVSPRTSNPSGPGAAVPIRIESSSSHVAEGQTLDLNCVVPGHAHAQVTWHKRGGSLPAHH
QAHGSRLRLYQVSPADSGEYTCRVLGSSGPLEASVLVSIEPAGSSTVHVPASGGAPPIRI
ETSSSRVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPAHHQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVHGSQLRLPHVSPADSGEYVCRVAVGSGPEQEASFTVTVPP
SAGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHEGATPINLEWKTRNPELEDNVHISP
NGSIITIVGTRPSNHGAYRCVASNAYGVAQSVVNLSVHGPPTLSVLPEGPVQVKVGKDIT
LECVSAGEPRASARWTRVGTPAKMEPRMFGLLDSHVVLKISSAKPSDAGTYVCLAQNALG
TAQKQVEVIVDTGTVAPGAPQVQVEEAELTLEAGRTATLRCSATGNPTPTIHWSKLRSPL
PWQHRLEGNTLVIPRVAQDSGQYICNASSPAGHAEATVILHVEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXPSGSLPDTSGKAGSPPTVQVTPQLETKSIGANVEFHCAVPSDRDTQLRW
FKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYVCQAHGPWGQAQASAQLVVQALPSVLINT
RTSVQSVVVGHSIEFECLALGDPKPQVTWSKVGGRLRPGIIQSGSIIRIAHVELSDAGQY
RCTATNSAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAVFPCMASGYPTPDITWSKLDG
DLPPDSRLENNMLMLPAVRPQDAGTYVCTATNRQGKVKAFAYLQVPERVVPYFTQTPHSF
LPLPTIKDAYKKFEIKIIFRPDSADGMLLYNGQKRTPGGPTNLANRQPDFISFGLVGGRP
EFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGNLAPVNGTSQGKFQGLDLN
EELYLGGYPDYSAIPKAGLSSGFVGCVRELRIQGEETVFHDLNLTAHGISHCPTCQDRPC
QNGGQCYDSESSSYKCVCPAGFTGSRCEHSEALHCHPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXVTVTTPSMSGTGSYLALPALTNTHHELRLDVEFKPLAPDGILLFSGGKS
GPVEDFVSLAMAGGHLEFRYELGSGLAVLRSPEPLALGRWHRVSAERLNKDGKLQVNRGR
PVLRSSPGKSQGLNLHTLLYLGGVEPSVKLAPAANVSAHFHGCVGE
Download sequence
Identical sequences ENSDORP00000012335 ENSDORP00000012335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]