SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012383 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012383
Domain Number 1 Region: 227-438
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.72e-56
Family Reprolysin-like 0.00072
Further Details:      
 
Domain Number 2 Region: 1173-1233
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000106
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 932-994
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000732
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1122-1176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000419
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 526-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 6 Region: 821-873
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 1325-1371
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 1059-1104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 1440-1486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000876
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012383
Domain Number - Region: 1621-1665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000811
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012383   Gene: ENSDORG00000013168   Transcript: ENSDORT00000013170
Sequence length 1866
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5433:4993:99422:-1 gene:ENSDORG00000013168 transcript:ENSDORT00000013170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVKTLASYEVVTPMRVNEFGEVFPQSQHFSRKKRSSEGREPTPFRTHYRISAYGQLFRL
NLSADATFLAAGYSEVHLGSPARGARGNEPGPSDLRHCFYRGQVNAREDHRAVFSLCGGL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPIKNI
TLPFHNHSYVSEDLSQMKERVFRISSENVSLEVEGKQSHSRNKRFLSYPRYVEVMVTADA
KMAHFHGQNLQHYVLTLMSIVAAIYKDSSIGNLIEIVIVKLVVIHKEQEGPVINSNAAAT
LRNFCLWQQTQNVPEDSHPSHHDTAVLITRQDICGAKEKCDTLGLAELGTLCDPTRSCSI
SEENGLSAAFTIAHEIGHVFNVPHDDSFKCKEYGVKNQYHVMAPTLNYHTSPWTWSTCSQ
KYITEFLDTGQGECLLDKPNESVYTLSSQLPGLLYDVNKQCELMYGPGSQVCPYLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCFHGRCVNRDMELRPVDGDWGPWGPYTSC
SRTCGGGIKSSTRLCDRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXAAGCDHVLNSKAKRDKCGVCGGDDSSCKTVTGVFNSSARYXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLSDSQGNFLLNGNFVVSMSKKEINIQGAIFEYSGSNHSVERIN
STDRLEEELVLQVLCVGDLYNPNVHYSFNIPVEEKSDLFKWNPQGPWGDCSKMCQGLRRR
KVVCIRQSDRMVVPDQRCDHLLLPEFVTEECNTDCELXXXXXXXRSHCSSACGPGSRSLD
IRCMKYSIHKGQTAPVDDQHCRDQLKPPLREPCRGDCGVIRWHYSEWSQCSRSCGGGQRT
RDAYCVNNFGRHLAEKECQQLARVTVERCNEVSCPGWATSEWSEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTATCGHGYQIRAVKCVGGPL
ELDGRECPAASRPTDKQDCMLPSCPVLPKAAATSLPATLLRKGAQWRHGSWTACSVSCGR
GKRARYVSCRDAKDERAEESACAHLPRPAEIEVCFSPCGEWRAGIWSPCSASCGQGKATR
QVVCVNSHQAIDENYCDPETRPATQQACVLAVCPPVQSHPRNFPFSHKPEVDKHPPSSIR
GNQWRTGPWGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXCSQTCGGGIRSRFVICQFPDGQVLPEHNCELQNKPPSVAQCHTHACPEGAAWNRG
PWEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
CSVTCGPGVQRRDVYCRLRGMGRVSEEACNGSTRPPFQRQCWREDCQRYRWVAGAWLHXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XCSMTCGTGVMERRVECRLENGWPTDLCLKHLKPDSQKKCYAHDCKSLSTCKEIQVTHNT
TKDGDYYLNIKGRIIKVHCSGMNTGNPTEYLPLVKSEDNFSEVYGLRLENPHECPFNGSR
RQDCKCKNDYLAAGYTVFRKIRIDLLSMQIKTMDLLYSQTIFGKTVPYATAGDCYSAARC
PQGQFSINLTGTGVKISSTAKWLAQGRYSSIIVHRSQDGAKVYGRCGGFCGKCAPHVATG
LPIQVL
Download sequence
Identical sequences ENSDORP00000012383 ENSDORP00000012383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]