SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012404 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012404
Domain Number 1 Region: 411-611
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-66
Family Hemopexin-like domain 0.00000000327
Further Details:      
 
Domain Number 2 Region: 322-392
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.31e-22
Family Matrix metalloproteases, catalytic domain 0.00013
Further Details:      
 
Domain Number 3 Region: 224-281
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-21
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 4 Region: 284-340
Classification Level Classification E-value
Superfamily Kringle-like 2.4e-20
Family Fibronectin type II module 0.0000897
Further Details:      
 
Domain Number 5 Region: 1-56
Classification Level Classification E-value
Superfamily PGBD-like 7.85e-18
Family MMP N-terminal domain 0.0000551
Further Details:      
 
Domain Number 6 Region: 61-126
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-16
Family Matrix metalloproteases, catalytic domain 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012404   Gene: ENSDORG00000013188   Transcript: ENSDORT00000013191
Sequence length 611
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_828:27381:46718:1 gene:ENSDORG00000013188 transcript:ENSDORT00000013191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYLNTYYGCPKESCNLFVLKDTLKKMQKFFGLPQTGELDQNTIETMRKPRCGNPDVANYN
FFPRKPKWDKNQLTYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFARIHDGEADIMI
NFGRWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGRKDGFLCSTTYNFDKDGKYGCPHEALFTMGGNADGQPCKF
PFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPF
TFLGNKHESCTSAGRSDGKLWCGTTSTYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEH
SQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGASPDTDVDVGTGPTPTLGPVTPELCEK
DIIFDGISQIRGEIFFFKDRFIWRTGTTTPGEKPMGPLLVATFWPELPEKIDAVYEAPQE
EKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDLQRVDAAFNWSKNKKTYIFAGDKFW
RYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSFFFKGAYYLKLENRSLKSVK
FGSIKSDWLGC
Download sequence
Identical sequences ENSDORP00000012404 ENSDORP00000012404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]