SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012459 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012459
Domain Number 1 Region: 112-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000142
Family Cripto EGF-like domain-like 0.0037
Further Details:      
 
Domain Number 2 Region: 81-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012459   Gene: ENSDORG00000013250   Transcript: ENSDORT00000013250
Sequence length 216
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_22954:13842:20364:-1 gene:ENSDORG00000013250 transcript:ENSDORT00000013250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFIISLALQLIHLGNSYQSETRQSGKEAGKIAAPKLQPTTLNLTLSDFRKDNGSEEEWR
LRESALYSRASDGRVFPRLRCCRNGGTCVLGSFCVCPPHFTGRYCEHDQRRSDCGALVHG
AWTFRGCRLCRCIFAALHCLPRQTQGRCDLKDLLTSFASGPSAHGRLSLLLLPSVLLHCL
IHEENPKCTVPPRTAKPNLQQELRPNRRPRAGHILY
Download sequence
Identical sequences ENSDORP00000012459 ENSDORP00000012459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]