SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012571 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012571
Domain Number 1 Region: 73-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.37e-38
Family Ankyrin repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012571   Gene: ENSDORG00000013373   Transcript: ENSDORT00000013371
Sequence length 239
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5137:2697:4654:1 gene:ENSDORG00000013373 transcript:ENSDORT00000013371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEKINHDEKTDAENSPDFSDHFNQLELLKTHGHLIPTGTQSLWLGNSDEDEEQDEKSE
EWYQLQEKKMEKDPSKLLLWAAENNRITTVQRLLSEKAAHVNTRDDDEYTPLHRAAYSGH
LDIVRELVAQGADIHAITVDGWTALHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL
AAGNRDSKDTLELLLMNRYIKPGLRNNLEETAFDIARRTSIYHYLFEVVESCTNSSPKS
Download sequence
Identical sequences A0A1S3ELR5
ENSDORP00000012571 XP_012864890.1.60039 ENSDORP00000012571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]