SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012576 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012576
Domain Number 1 Region: 319-619
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-55
Family WD40-repeat 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012576
Domain Number - Region: 49-80
Classification Level Classification E-value
Superfamily RING/U-box 0.011
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012576   Gene: ENSDORG00000013376   Transcript: ENSDORT00000013376
Sequence length 623
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3515:46748:135461:-1 gene:ENSDORG00000013376 transcript:ENSDORT00000013376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRNQPTGTCSARTSSRTSVASSMTLAFXXXXXXXXXXXXXXXXXXXXYKCIHQSLEDNN
RCPKCNYVVDNIDHLYPNFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXESHAAQLQILMEFLKVARRNKREQLEQIQKELSV
LEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPW
YNSTLASRRKRLTAHFEDLEQCYFSTRMSRISXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIEFDRDCDYFAIAGVTKKIKVYEYGTVIQDAVDIHYPENEMT
CNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNVMDPKL
LASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNT
KQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGL
ASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRAL
PDGESNVLIAANSQGTIKVLELV
Download sequence
Identical sequences ENSDORP00000012576 ENSDORP00000012576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]