SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012653 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012653
Domain Number 1 Region: 95-235
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.31e-60
Family Inorganic pyrophosphatase 0.0000037
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012653
Domain Number - Region: 3-51
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.00458
Family Inorganic pyrophosphatase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012653   Gene: ENSDORG00000013455   Transcript: ENSDORT00000013455
Sequence length 281
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3262:16014:53347:-1 gene:ENSDORG00000013455 transcript:ENSDORT00000013455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVAGHYISPFHDIPLKVDIKEXXXXXXXXXXXXXXXNLFNMVLEVPGWTNAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTWEDPNQKDKNTDCCGDNDPIDVCEI
GSKVLSRGEVVQVKILGILALIDEGETDWKLIAINVNDPEAEKFHDIDDVEKFKPGYLEA
TLNWLRFYKVPEGKAENKFAFNGEFKNKAFALEVIKSAHECWKALLMKKCDGGGIKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVWHFLGK
Download sequence
Identical sequences ENSDORP00000012653 ENSDORP00000012653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]