SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012654 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012654
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000589
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012654   Gene: ENSDORG00000013456   Transcript: ENSDORT00000013456
Sequence length 165
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4314:1745:8521:1 gene:ENSDORG00000013456 transcript:ENSDORT00000013456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFEDISKYFSKDEWKLSYSQKISYVYMKRNYTTMSSLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXMDKQSAKKSSIQKGRSRAVDPHYCEKHVTPEKES
ASGKCSEKTSGSWRKKKNIWTHRLRERKNLVVYEEISDPEEDEEY
Download sequence
Identical sequences ENSDORP00000012654 ENSDORP00000012654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]