SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012666 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012666
Domain Number 1 Region: 242-489
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.2e-68
Family Leukotriene A4 hydrolase catalytic domain 0.00000063
Further Details:      
 
Domain Number 2 Region: 499-643
Classification Level Classification E-value
Superfamily ARM repeat 1.09e-37
Family Leukotriene A4 hydrolase C-terminal domain 0.00082
Further Details:      
 
Domain Number 3 Region: 22-235
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.89e-33
Family Leukotriene A4 hydrolase N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012666   Gene: ENSDORG00000013469   Transcript: ENSDORT00000013469
Sequence length 648
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2892:320526:339227:1 gene:ENSDORG00000013469 transcript:ENSDORT00000013469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDGARGGGTPRPLHSAQAVDVATASSFRAFEILHVHLDLRAEFGPPGPGPGSRGLGGQ
AVLELRCLLPAGAAELQLDSHRSLEVTAVTLRRGSPGLERSPAEPVSFHTRPFSHYGQAL
CVAFPQPCRASERFELVLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCF
DTPAVKCTYSALIEVPDGFTAVMSASSWQKRGPNKFFFEMHQPIPSYLIALAIGDLVSAE
VGPRSRVWAEPCLIEAAKKEYQGVVEEFLATGEKLFGPYVWGRYDVLFMPPSFPFGGMEN
PCLTFVTPCLLAGDGSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTIL
FGAAYTCLEAATGRALLRQHMDISGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVS
YLAHLVGDQDQFDKFLKAYVDEFKFKSIVAEDFLEFYLEYFPELKKRKVDSIAGFEFDRW
LNTPGWPPYLPDLSPGDSLMKPAEELAKLWVSAELDMQAIGAVDISSWKTYQLIYFLDKI
LQKSPLPPGNVQKLGETYPKISNAHNAELRLRWGQIVLKNDYQEDFWKVKAFLQSQGKQK
YTLPLYHAMMAGSEVARTLAKDTFASTASQLHSNVVNYVQQILEPKGS
Download sequence
Identical sequences ENSDORP00000012666 ENSDORP00000012666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]