SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012677 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012677
Domain Number 1 Region: 172-471
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.74e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000354
Further Details:      
 
Domain Number 2 Region: 26-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.18e-29
Family Anticodon-binding domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012677   Gene: ENSDORG00000013479   Transcript: ENSDORT00000013480
Sequence length 471
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1994:482:41998:-1 gene:ENSDORG00000013479 transcript:ENSDORT00000013480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSASAGRKNQEKPREIMDAAEDYAKERYGISSMIQSQEKSDRVLVRVRDLTIQKADEIV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKXXXXXXXXXXXXXXXXXXXXXXXXXXXEGRATVNQDTRL
DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVLEEIADTLVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGV
EMGDEEDLSTPNEKLLGRLVKEKYDTDFYVLDKYPLAVRPFYTMPDPNNPKHSNSYDMFM
RGEEILSGAQRIHDSQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGI
Download sequence
Identical sequences ENSDORP00000012677 ENSDORP00000012677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]