SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012701 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012701
Domain Number 1 Region: 39-96
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000303
Family VWC domain 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012701
Domain Number - Region: 1250-1293
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00209
Family Fibrinogen C-terminal domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012701   Gene: ENSDORG00000013502   Transcript: ENSDORT00000013505
Sequence length 1457
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_41:143061:158915:-1 gene:ENSDORG00000013502 transcript:ENSDORT00000013505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFVDLRLLLLLAATALQTHGQEADEVVRQHEDIPKISCIYDGIRHPNNQTWKPEPCLV
CICNNGTTVCDDVMCDTFDCLEPQMIEGECCPVCVEHSESCDQESLGVEGPKGDTGPRGP
RGPAGPPGRDGIPGKPGLPGIPGPPXXXXXXXXXXXXXXXXXXGYDESAGVSVPGPMGPS
GPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGER
GPSGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPR
GLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGARGSE
GPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPS
GAPGPKGNSGEPGAPGNKGDTGAKGEPGPAGVQGPPGPAGEEGKRGARGEPGPAGLPGPP
GERGGPGSRGFPGADGVAGPKXXXXXXGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSP
GSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPP
GAVGPAGKDGEAGAQGPPGPSGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGDQGVP
GDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGSNGAPGNDGAKGDTGAPGAPGSQGAP
GLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGES
GPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDSGAKGDAGPPGPA
GPAGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKE
GGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLP
GQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGCP
GRDGSPGPKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPIGPVGAR
GPAGPQGPRGDKGETGETGERGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPP
GSAGAAGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSGGFDFSFMPQP
PQEKADGGRYYRADDANVVRDRDLEVDTTLSLSQQIENIRSPEGSRKNPARTCRDLMCHS
DWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVFPTQPTVAQKNWYLSRNPKEKKHVWFG
ESMNGGFQFEYGSDGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDKQTGNLKKS
LLLQGSNEIELRGEGNSRFTYSTLEDGCSSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDI
GAPDQEFGIDIGPACFV
Download sequence
Identical sequences ENSDORP00000012701 ENSDORP00000012701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]