SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012703 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012703
Domain Number 1 Region: 581-855
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.11e-95
Family PDEase 0.00000000025
Further Details:      
 
Domain Number 2 Region: 135-331
Classification Level Classification E-value
Superfamily GAF domain-like 8.72e-45
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 317-520
Classification Level Classification E-value
Superfamily GAF domain-like 7.63e-37
Family GAF domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012703   Gene: ENSDORG00000013507   Transcript: ENSDORT00000013507
Sequence length 862
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3252:4520:126273:-1 gene:ENSDORG00000013507 transcript:ENSDORT00000013507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPIGPSSGPPRRDRDRDAIEAWLDDHRDFTFSYFVRKATREMVNAWFAERVHPIPVCKE
GIRGHPESCSCPVQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEK
KEHMPLTPPRFDHDEADQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCCDSFSSVFHMECEELEKSSDNLTRERDANKINYMYAQYVKNTMEPLNIPDVSKD
TRFPWTNETTGSVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKVEENTGKVKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHSAAEEETREQALEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLCRWILSVKKNYRKNVAY
HNWRHAFNTAQCMFAALKAGKIQSKLSELEILALLIAALSHDLDHRGVNNSYIQRSEHLA
QLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRG
EFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE
RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCLPLLDGCRKNRQKW
QALAEQQEKTLINGESGQAKRN
Download sequence
Identical sequences ENSDORP00000012703 ENSDORP00000012703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]