SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012744 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012744
Domain Number 1 Region: 254-345
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-16
Family APC10-like 0.0073
Further Details:      
 
Domain Number 2 Region: 1737-1797
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000553
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1695-1746
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000683
Family ZZ domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012744
Domain Number - Region: 1026-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000523
Family Spermadhesin, CUB domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012744   Gene: ENSDORG00000013546   Transcript: ENSDORT00000013549
Sequence length 2879
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_602:5357:207945:-1 gene:ENSDORG00000013546 transcript:ENSDORT00000013549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPTVPALPPAAALLEPARLREAAAALRPTPPCESLVSRHHGALLRWLEERLGRGEESVT
LEQFRELLEARGAGCSGEQFEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLKMKPDVVLRHLSIAVAASDQSYMPQQVTIAVGRSASDLQEVRDVHI
PSNVTGYVTLLENANISQLYVQINIKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASA
IWYWSLLTSLVTASMETNPAFVQTVLHNTQKALQHMPPLSLSPGSADFSTFLSPNVLEEV
DSFLIRITSCCSTPQVELTLLAFALARGSVAKVMSSLCTIIDQLDTQYDALSLISSMASV
RQNLLLKYGKPLQLTLQACDVKGKEDKSGPENLLVEPWTRDGFLTETGKTRASTLFSTGT
ESVFQVTQIIIMVRRGGIGAQCGLVFAYNSSSDKFNAEEHFKRFEKYNRWKLQELRQFVK
HRAGCSSEDLGEGVPIGWVELEEERDETDVKLQQCRIAKYLMMKFLCTRQESAEHLGVQS
LSISGYLLPVRAEAEQSMLCAHCKNDTESTCGATLLLRTLQFIQQLAHDLVQQKSGVKYI
SFLDFTGLDLQIFWKFYSKLEQSSREECICAKTQFLQSCFTVLQGDVPTASEEGKPPALH
PEKVQAAKELCTHLCDVVDKVDGDSVLVEILKQEVKKTLLNGAAIFFPDRQTRWNHLFTM
MNITEQEHKQSLQLTFHSLCIYFSDKDPGGLLLLPETSDLPGMNIRKVLAVTNPLSVAAE
CELLMLSEAGEVASVVFSLFWSVQGSLLSRCHLQLKSTDSGAKDLAVYLIEKYVGQFLAS
MRGILEYLLSQNSKTVVEKLCNSVFSMAAHQLVIFLLDLDVETWQQEQPVVLHTWTKESA
HNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEFTDSRGGKTRYDTKVGTYKWP
KKVTFKDGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWGLDLQLLVSRLMGRLASQ
CMALKSVHQLGSNLAVPQAKMASVLNSPLWKPVFRHQICPGLELEASWPTHLHQNEKEVK
KIPDDPCRRFLLDFAQSEPAQNFCGPNSELFKGFIQACRKQAPKTDIVAGSTIDQAVNAT
FAALVYRTPDLYEKLQKYXXXXXXXXXXXXXXXXXXXXXXXXXXXLEMKQKSLMSLGNEA
EEKLSSEAVEANPESLAKECIQKSLLLLKFLPMDKSSEETFDKLVTVNETDHLQPLDRHQ
RTSSVVEEHFQASASPTEAGPSTAGDNSPDWEVPSKLPPSSGPPSAEVPTAEEPSSPSTP
TRRPPFTRGRLRLLSFRSMEEARPLPTVKEKYPVLKDAMDFIKDQSLSYDSVVKVLSLKK
AQAKSILEALRVIQYCTESLGQPHCFHPPYVLFLLELLTCQKDFTNYFGHLEGCGADLHK
EIRDTYYQLVLFLVKAIKGFNSINDRSLLPALSCIQTALLHLLDMGWEPCDLAFFVDIQL
PDLLMKMSQENISVHDSMISQWSEEDELADAKQNSEWMDECQDGMFEAWYEKIAQEDPEK
QRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGVKPEGHGDD
HEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYAAKKYSYGHLPTHSITAHPMVTI
RISDRQRLIQPYIHNYSWLLFAALALYSAHVTSTEDMDGEKLGPQARSSAAILRSQCMQL
VGDCLMKAHQGKGLKTLALLGILPDGDSTPEHQALPITVSTPTSEEQLEKKTVHPTQQLS
ETGSLVQCNGKRAVEKEIRPLDSRQRKKASLLLMKDSSCQIQISDVPTDAHTPPGPPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPTLPLIDLEHVLPLM
FQVVISNAGHLNETYHLTLGLLGQLIIRLLPAEVDAAVIKVLSAKHNLFAAGDSSIVPDG
WKTTHLLFSLGAVCLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDNANEPHNVIIKHFTEKNRAVVDAKTRKRKTVKD
YQLTQKGGGQECNDSETQLSQYSQHFAFIASHLLQTSMDSHCSEAVEATWILSLALKGLY
KTLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILSIMLYSSKKEINAL
ADHRDLELDERGDQEEEVDRPISSPGEPEQKKLDPLEGLDEPTRICFLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRNVPVSEDILELSGPAHMTYIWDMFMQLE
EKHQWEKILQKVLQGCRENMLGTMALAACQFMEEPGMEVQVRESKHPYNNNTSFEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRFS
DMSNTEWGYKFTVTAGHGRFQTGFEILKQMLSEERVVPHLPLAKIWEWLVGVACRQTGHQ
RLKAIHLLLRIVRCCTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXELGLLQEYLLALTTDDHLLRCAAQALKNVAAISLAINYPNKATHLWNVEC
Download sequence
Identical sequences ENSDORP00000012744 ENSDORP00000012744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]