SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012760 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012760
Domain Number 1 Region: 67-374
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.62e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00092
Further Details:      
 
Domain Number 2 Region: 361-473
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.03e-18
Family Anticodon-binding domain of Class II aaRS 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012760   Gene: ENSDORG00000013567   Transcript: ENSDORT00000013567
Sequence length 476
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5980:58136:59566:-1 gene:ENSDORG00000013567 transcript:ENSDORT00000013567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLTRCRALCTLATCSLQLSRCVPHRCHHCAPEKGQRLVLSKMFQPQNLREDQMPIPE
GKSDSLTCKSQRLMLQVGLILPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNLP
SLCPAELWQATGRWDLMGKELLKLRDRHGKEYCLGPTHEEAVTALVASQKKLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQHTYRLVCDAYCSLFDRLGLP
FLKAQADVGSIGGMLSHEFQLPADVGEDQLAVCPSCNFSANIELLDPSQANCPTCQGPLT
QTKGIEVGHTFYLGTKYSSIFNAQFTNAHGKPSLAEMGCYGLGVTRILAAAIEVFSTEDC
IRWPSLLAPYQVCLLPPKKGSKETEATELTGHLYDHITEVVPQLRGEVVLDDRTHLTIGN
RLKDADKLGYPFVIITGKRALEDPAHFEVWCQNTGEVVFLTQEGVMELLRTQVQVV
Download sequence
Identical sequences A0A1S3FPD2
ENSDORP00000012760 ENSDORP00000012760 XP_012877702.1.60039 XP_012877703.1.60039 XP_012877704.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]