SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012777 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012777
Domain Number 1 Region: 25-607
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-219
Family Neurolysin-like 0.00000000000000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012777   Gene: ENSDORG00000013589   Transcript: ENSDORT00000013589
Sequence length 805
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_841:123689:163328:-1 gene:ENSDORG00000013589 transcript:ENSDORT00000013589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSSWLLLSLIAVTASQSSIEELAKTFLDNFNQEAEDLSYQSSLASWNYNTNITEENAQ
RMNEAGAIWSAFYEEQAKLAKIYSLQEIQNPILKRQLQFLQQSGSSALSEDKSKRLNTIL
NKMSTIYSTGTVCNPNNPQECLLLEPGLDDIMAKSTDYSERLWVWEGWRSEVGKQLRPLY
EEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNRNQLIEDVERTFAEIKPLYEHL
HAYVRAKLMDIYPSHINPTGCLPAHLLGDMWGRFWTNLYSLVIPFEQKPNIDITDAMVQQ
AWDADRIFKEAEKFFVSVGLPKMTQGFWENSMLTEPGDNRKVVCHPTAWDLGKGDFRIKM
CTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAVTPKHLKS
IGLLPPNFHEDNETEINFLLKQALTIVATLPFTFMLEKWRWMVFRGEIPQEQWMKTWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDFSFIRYYTRTIYQFQFQEALCKAAKYEGPLH
KCDISNSVEAGHKLLNMLRLGKSEPWTLALENVVGAKNMDVRPLLNYFEPLFIWLQEQNK
NSFVGWNTAWNPYNDQSIKVRISLKSALGDKAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEENVKVENLTQRISFTFYVTMPNNSSDIVPRDEVEAAITMSRGRINDIFCLDDN
SLEFLGINPTLGPPYQPPVTVWLIAFGVVMGLVVIGLVFLIVVGIRERRKRSEIRREDNP
YASVDISKGEMNAGFQNTEDVQTSF
Download sequence
Identical sequences ENSDORP00000012777 ENSDORP00000012777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]