SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012789 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012789
Domain Number 1 Region: 427-488
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.22e-19
Family Fibrinogen C-terminal domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 269-336
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.98e-19
Family Fibrinogen C-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012789   Gene: ENSDORG00000013601   Transcript: ENSDORT00000013601
Sequence length 489
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2019:40001:55712:-1 gene:ENSDORG00000013601 transcript:ENSDORT00000013601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFIWTLGVLFFLLMGTGHCRGGQFKIKKITQRRYPRATDGKEEAKKCAYTFLVPEQKI
TGPICVNTKGQDSGTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLR
KESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYA
SLTHLVNNQSVMITLLEEQCMRIFSRQDTHASPPLVQVVPQHIPTSHHYTPGLLGGNEIQ
RDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEPFKDCQHAKEAGHSVSGIYMIKPENS
NGPMQLWCENSLDPGGWTVIQKRTDGSVNFFNWENYNXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRA
VQMMIKPID
Download sequence
Identical sequences ENSDORP00000012789 ENSDORP00000012789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]