SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012866 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012866
Domain Number 1 Region: 147-343
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-56
Family Prokaryotic proteases 0.0000000185
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-24
Family HtrA-like serine proteases 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012866   Gene: ENSDORG00000013684   Transcript: ENSDORT00000013683
Sequence length 458
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_380:11860:14750:1 gene:ENSDORG00000013684 transcript:ENSDORT00000013683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRAWRGTGWSLRAWRDLGGFLWGKRPLLTPDLRALLTSGTPAPRARLTCGTPSLLAR
LSVGVPEPRACLRSGIPNSWARWTTGVPDPQTQEVSETPGARPRVWLAVALGAGGAVLLL
LWGGGRGPPSVLAAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPIS
NGSGFVVASDGLIVTNAHVVADRRRVRVRLRSGDTYEAMVTAVDPVADIATLRIQTKEPL
PTLPLGCSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLLRGEKKNSWFGISGSQRR
YIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEHL
VQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE
Download sequence
Identical sequences ENSDORP00000012866 ENSDORP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]