SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012876 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012876
Domain Number 1 Region: 497-614
Classification Level Classification E-value
Superfamily Cap-Gly domain 8.12e-34
Family Cap-Gly domain 0.0000623
Further Details:      
 
Domain Number 2 Region: 296-379
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.93e-30
Family Cap-Gly domain 0.0000316
Further Details:      
 
Domain Number 3 Region: 631-710
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-26
Family Cap-Gly domain 0.0000128
Further Details:      
 
Domain Number 4 Region: 132-215
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000108
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012876   Gene: ENSDORG00000013693   Transcript: ENSDORT00000013693
Sequence length 722
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1952:7759:46272:1 gene:ENSDORG00000013693 transcript:ENSDORT00000013693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMTIEDLPDFPLEGNNLVGRYPFLFPGSETPVIFSISAAPMPSDCXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXDVETAVKFAAQLIDLGADVSLRSRWTNMNALHYAAYFDVPELISLILKTSKPKDVD
ATCSDFSFGTALHIASYNLCAGAVKCLLEHGANPAFRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGTL
RFCGTTEFANGQWAGIELDEPEGKNNGSVGKVQYFKCAPKYGIFAPLSKISKAKDRRKNI
THTSSTKAVPLTRSLKVDVAPVAAKVNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
LHGTMSSSSSTSSLEHKQNVSKKTNSSNSSKKTTSKSPSLSSRASAGIYGFFNQAYLVFL
ILVCLFEFFNNICSNPRREGELHLGDRVLVVGQRVGTVKFFGTTNFAPGYWYGIELEKPH
GKNDGSVGGVQYFSCSPRYGIFAPPSRVQXXXXXXXXXXXXXXXXXXXXXXXFRRSFSTT
SASSQKEINRRNAFAKSRTALRRSWSSATASGGLEGGVKLQEGAQVLLTSSNEMATVRYL
GPTDFAAGIWLGLELRSAKGKNDGAVGDKRYFTCKPNHGVLVRPSRVTYRGINGSKLVDE
NC
Download sequence
Identical sequences ENSDORP00000012876 ENSDORP00000012876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]