SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012987 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012987
Domain Number 1 Region: 30-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-38
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012987   Gene: ENSDORG00000013815   Transcript: ENSDORT00000013815
Sequence length 1736
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6602:7556:39037:-1 gene:ENSDORG00000013815 transcript:ENSDORT00000013815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCSRCHRLLLLLPLVMALSTAPGWAGAPSVDVLRALRFPSLPDGVRRTRGICPADAAY
RVSRPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVQQLGLELGRPV
RFLYEDQTGRPQPPAQPVFRGLSLADGKWHRVAVAVKGQSVTLIVDCKKRVTRPLPRSAR
PVLDTRGVVIFGARILDEEVFEGDVQELAIVPGVQAAYESCEQKDLECEERPRDRPQNQQ
SHRAQRSPKQQPSRLHRPQNQEPQRQPTESLYYDYEPPSYDVMTTGTTPDYQDPTPGEDE
EVLESSPLPLLEEEHMDLQVPPTADRFQAEEYGEGGTDTPAGLYDYTYGYGDDYHEETEL
GPALSAEKAHSGAAAHGPRGLKGEKGEPAVLEPGMFVEGPPGPEGPAGLTGPPGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSSAGEKGPMVAAQEAQAQAILQQ
ARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRA
GADGARGMPGEPGVKGDRGFDGLPGLPGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPR
GLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGTQGLP
GPQGAIGPHGEKGPRGKPGLPGMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPR
GVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPT
GDPGPPGLLGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKAGPRGER
GPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPPGKD
GLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGTAGESGPMGERGHPGPPGPPGEQGLPGTA
GKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGSGLKGNEGPAGPPGPAGSPGER
GAAGSGGPIGPPGRPGPQGPPGAAGEKGVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRADEEPGAREPQGHFGAK
GDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPP
GGVGNLGPPGQKGEPGESGSPGVQGEPGVKGPRGERGEKGESGQAGEAGPPGPKGPTGDD
GPKGNPGPVGFPGDPGPPGEGGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKR
GPAGTPGPEGRQGEKGAKGDPGAVGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGRP
GATGQAGPPGPVGPPGLPGLRGDAGAKGEKGHPGLIGLIGPTGEQGEKGDRGLPGPQGSP
GQKGETGIPGASGPIGPGGPPGLPGPAGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGEV
IQPLPIQMPKKTRRSVDGSRIVQEDEPMPTGGAPGTPGGLEEIFGSLDSLREEIEQMRRP
TGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVT
QFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSGVSRDGPLRLRGANEDELSPETSP
YVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSDLGAPTRRGGVLLGPVCFMG
Download sequence
Identical sequences ENSDORP00000012987 ENSDORP00000012987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]