SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013006 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013006
Domain Number 1 Region: 161-344
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.8e-54
Family Reprolysin-like 0.00000273
Further Details:      
 
Domain Number 2 Region: 363-438
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 7.85e-21
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013006   Gene: ENSDORG00000013834   Transcript: ENSDORT00000013834
Sequence length 856
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5387:11061:71295:-1 gene:ENSDORG00000013834 transcript:ENSDORT00000013834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPSAAELRVVAEGRELILDLEKNEYLFAPAYTETHYTPSGTPQTTTLKSENHCFYHGTVR
HAGDSSVTLSTCRGIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGFEHSR
PTAGNAQFTQQTKKQPRRXXXXXXXXXXXXXXXXXXXXXXFEKNRRDQDATKHKLLEIAN
YVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLKQKYHDNAQLIT
GLSFHGATIGLAPLMAMCSMYQSGGVNVDHSENAIGVAATMAHEMGHNFGMSHDVKHCCP
ASAQDGGCIMAAATGHPFPRVFNGCNRKEMDRYLQSGGGMCLSNMPDTRTLYGGRRCGNG
YLEDGEECDCGEEDECDNPCCNASNCTLKEGLECAHGACCHNCKLVAPGTLCREQAGQCD
LPEFCTGKSPHCPSNFYQMDGTPCESGQAYCYIGMCLTYHDQCQRLWGPRAWTASDACFE
KVNVAGDHFGNCGRDIHGQPKKCNIRDVKCGKIQCHIPDAQAKESNAVPIKTTITLNKQT
IECYGVHFYRSNEDEVDSLDPGLVMTGTKCGPDHXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGPVVAGVFSALFVLVVFLLICH
CCRQNSKLSQLQPLALPSKLRQQFSCPFRVSQNSGSGHANPTFKLRTPQGKRKVSSTPEI
FRKPSQPPPRPPPDYLRDQSPTAPPPTHLNRVPKSSPSPGVQVQRKESSRGPPPSRPAPP
APNCLLSQDFARPRPPQKALPANPVPGRRAFPRPGSGPALQPPAAGPPHIQPLIAPAPRL
PQYRSQRTGAMTSSKI
Download sequence
Identical sequences ENSDORP00000013006 ENSDORP00000013006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]