SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013026 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013026
Domain Number 1 Region: 231-437
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.66e-29
Family Reprolysin-like 0.0049
Further Details:      
 
Domain Number 2 Region: 525-582
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000432
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 931-989
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000122
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 864-928
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013026
Domain Number - Region: 1079-1122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000115
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number - Region: 821-869
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0536
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013026   Gene: ENSDORG00000013854   Transcript: ENSDORT00000013854
Sequence length 1166
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3676:4194:98528:1 gene:ENSDORG00000013854 transcript:ENSDORT00000013854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDLVSAYEVDHRGEFVSHEITHHQRRRRAADRPGGDTLHLRLKGTRHDFHLDLKAASSLV
APGFLVQTLGRQGTTSVHAFRAEDLCFYQGSLRHQRNSSVALSTCQGLSGMIRTDEADYL
LKPLPASLAGTHSGCPPAGPCSPSHVLYKRSTEPRAPRAPQANEILMVARKREVASQSLR
DDRPPQKQHFCGRRKKYMPQPPSEDLFILPDEYQPGLRHKRSPLKSPQKDELNVETLVVV
DNRMMRNHGHGNITTYVLTVLNMVSALFKDGTIGGNINIAIVGLILLEDEQPGLVISHHA
DRTLSSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXFGMVHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSPCSRQY
LHRFLSTAQAVCLADQPKPVKEYKYPEKLPGELYDANTQCKWQFGEKAKLCLLDFRKDIC
KALWCHRIGRKCETKSMPAAEGTACGQDTWCRGGQCVKYGDEGPRPTHGHWSDWSPWSPC
SRTCGGGVSHRDRLCTNPRPSHGGKFCEGAARTLKLCSRQQCPQDSVDFRAAQCAEYNSK
RFRGWLYKWKPYTQVEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCVDGMCE
RVGCDNVLGSDATEDSCGVCKGNNSDCTMHRGLYSRHHHANHYYHVVTIPPGARSIRIYE
TNVSTSYIAVRNAFNAYYLNGHWTVDWPGRYRFSGTAFDYRRSFKEPETLTSAGPTNETL
VIELLFQGRNPGVAWEYALPRAGMEKPPPAKPSFSWAILRSECSVSCGGGQMTTKEGCFR
DLRVPVNTSFCNPETRPVTGLVSCKVSACPPSWSVGNWSACSRTCGGGTQSRPVRCTQRA
RYHAEPVPASRCPQPAPSSHQACNSQSCPPAWSTGPWAECSRTCGKGWRKRTVVCKSTNP
AARAQLLPSTACDPELKPKTQEACLPRRCHKPRKLQWLVSAWSQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXC
TASCGGGVKRRTVHCLSGGRPASSCSQEHRPEASLACNTHFCPVVEQQDTFCRDYFHWCS
LAPQHGVCSHGFYSKQCCKTCAESNL
Download sequence
Identical sequences ENSDORP00000013026 ENSDORP00000013026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]