SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013059 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013059
Domain Number 1 Region: 26-138
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000067
Family C-type lectin domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013059
Domain Number - Region: 1458-1506,1544-1654
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0126
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number - Region: 812-843
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.0136
Family Lipoxigenase N-terminal domain 0.042
Further Details:      
 
Domain Number - Region: 279-354
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0615
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013059   Gene: ENSDORG00000013894   Transcript: ENSDORT00000013894
Sequence length 1709
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6162:951:47170:-1 gene:ENSDORG00000013894 transcript:ENSDORT00000013894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFHGRTWVCLLLGTGVLALEWSNREQHGKRRCYQLNRLSCNFQDAEHYCRTQEGRLAHTW
NQGAQNLIQKFLKEETAWWVGQNLIQSKEHQRRDHPAGAGFPWPPGPRSCPHCYIMFQRA
NEILSRLDLCSKRHYFICQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSKTLCHPGNPFPAVVLKTTPKAPSTMSAPSSPPWSTETELPRPA
ATTPATAPQADMATSPGGDSQQGVSTAPPQGSPHNTSNQVSSELAKHLSPTRRELKKACE
TLQNLRDLAPSFQSPAQVPVVNLLIDLTEQILRIPSQNRGTRGSETPATLCHFPPPSVMN
GEVEKLQTPKQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNIS
TLPLSSYTLGGPAPVSLGLPSSSALEAFLNKYPRVKVQVTGLAFNPFQTFDGRNITGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNANIDTHASSNTSTRFTASVNVTSVERSLLV
TIEPASPLFLTLYVGFQYPPNHTFLLTTTLPKSTTGQKDEDYTWVLTPDSLQYRTGTYYI
TAILNETETAWQTPILVSVVTAVTQCYFWDKNNRTWKSSGCQVGLRSTVVKTQCLCDHLT
FFGSDFFIVPRTVRVEDTVTLFRHVSNNPVGVSLLASLGLYMFLAVWAWRKDQRDMQKVK
VTVLGYNDPGSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYISQVIVSDMATKKKWHFLCDCWLAKDL
GDFQCDRVFTPASRTELLSFRHLFSSTIVERFTQDHLWLSIATRHPWNQFTRLQRLTCCT
TLLLCDMVINVMFWRMEGPTAKRVEPMGPFAVTWLEVLISIQTAVILLPAHLVIRQLFLW
IQPREALPLLPPLPAACPPGAAWEPSSSAEVVEELKETVGFLLRRDTRLLADCEPPVQTP
HDMSQLVMLLSRIIHSHLEEQGYCRHSEPQGPSVASETQYHFHWYLHRVLRRLEAHLDTL
ATTQGHQPCDLREAASQLQKLQELLETRVLPMEKGAARETTSFPMLSPEAGKRPRCVFPP
ALLTSICWLLLGVTSLASAFFTALYSLDLSKDQATSWAVSMMLSALQDTFISQPVKVIVF
TFLLSLLASRMPWLNKEKEQQRILALWAKCSSSLSGSRDKNNPIYKPPVVTRPTNDPKRT
WKKKKLLKLTGDMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLFTSVRLES
LTSLQTSEKGFAWTTASQVAHYLLVCYYTFKQGCWLKQQKWRFFTRKRNVLDLSIVVISF
SILGLDMKRISLHKKNMAQYRRDPERFISFYEAVNVSCAVTHLVGFLVLLATVQLWNLLL
HNPRLKVISNTLSKAWDEVVGFLLVILILLSSYAITFNLLFGWSIADYQTFFSSAVTVVG
LLMGISHHEEVIDLHPVLGSFLILSNVILMVFVIINLFSAILIAFGKERKSLQKEAALAG
MLLQKLSNLLGISAEEVMTMGIDVLSVFP
Download sequence
Identical sequences ENSDORP00000013059 ENSDORP00000013059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]