SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013076 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013076
Domain Number 1 Region: 73-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-41
Family Eukaryotic proteases 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013076   Gene: ENSDORG00000013911   Transcript: ENSDORT00000013911
Sequence length 256
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1016:21079:40435:1 gene:ENSDORG00000013911 transcript:ENSDORT00000013911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAHWFLLLLLALGALWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIQLLRLVLGLHGLHDRHDPGLTFHIKAAVRHPGFKPNLENDLMLLKLDG
KVKPSRTIQPLAVARRRRAIPAGTKCSVAGWGVTHPTERLALRLHELDVRVLHAKMCNNS
RFWNGNITHHMLCLAADAKDQAPCKGDSGGPVICDKGQVDGILSFSSKTCINVFRPPVAT
AVSPYVPWIRKIIGRW
Download sequence
Identical sequences ENSDORP00000013076 ENSDORP00000013076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]