SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013090 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013090
Domain Number 1 Region: 101-278
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-48
Family Eukaryotic proteases 0.000000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013090   Gene: ENSDORG00000013925   Transcript: ENSDORT00000013925
Sequence length 281
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1121:7481:17730:-1 gene:ENSDORG00000013925 transcript:ENSDORT00000013925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSLTLLHLLPLLEVKSKQRCSSRSCGLSSLPGRMQLLLFLLAFCLPPTAKTXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFINVTLGAHNIKEREKTQQ
VIPVKKAIPHPGYNPRNHSNDIMLLQLQRKAKLTTAVKPLKLPKGRSHVKPGQVCDVAGW
GRRTPKGQCSNTLQEVELIVQEDQMCESHLEGYYNSVSQICVGDPKMKSSSFKGDSGGPL
VCNNVAQGIISYGKANGTPPRACTKISKFSHWIKKNMKRYQ
Download sequence
Identical sequences ENSDORP00000013090 ENSDORP00000013090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]