SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013109 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013109
Domain Number 1 Region: 1501-1613
Classification Level Classification E-value
Superfamily C-type lectin-like 2.59e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000408
Further Details:      
 
Domain Number 2 Region: 1389-1498
Classification Level Classification E-value
Superfamily C-type lectin-like 3.77e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013109   Gene: ENSDORG00000013942   Transcript: ENSDORT00000013944
Sequence length 1615
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5147:1620:79297:1 gene:ENSDORG00000013942 transcript:ENSDORT00000013944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKGFPGPPGFPGQKGFPGPESSPGPRGPKGSPGLPGLTGPKGVRGISGLPGYSGPPGLP
GIPGNSGPYGLPGLPGCNGSKGDQGFPGIPGTPGYPGFQGATGLKGQKGAPAQREDGEIN
GKGDPGVPGPPGFQGLPGPPGFPGPPGPPGPPGIFGFPGAPGPRGPKGYMGDNVVGQKGE
RGIKGLTGPPGPPGTVIVTLTGPENRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGKPGKDGAPGGAKGHRGFPGLRGEVGLKGWKGDPGPPGFRGPTEYYDTYWQK
GDAGIPGPPGPKGVRLPXXXXXXXXXXXXXSSKPGSSGASGWPGLKGSKGKTGLSGKDMV
GLPGSPGCPGXXXXXXXXXXXXXXXDVIFRKGPPGDRGPPGHPGSPGTPGVDGPKGEAGL
VCTQCSYIPGPPGLPGLPGFDGLKGIPGGQGPAGAKGSPGSPGSAPPGFPGFPGALGAPG
FKGEKGETPQPQGQMGVPGEPGPRGPPGRKGLDGTPGSPGLKGSPGPKGDPALSGEKGDR
GLPGNPGSPGPPGPEGPAGPPGCGPQGEPGPKGTQGVPGAPGLPGKAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLPGSMGRCDPGLPGPEGEPGIPGIGLPGPPGPKGDRGLLGA
KGPPGYPGKMGEPGFPGDPGFPGAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRGEPG
PKGDPGIPGLDRSGAPGEPGPPGVPGHQGEMGPPGQKGRPGAPGPSGLPGERGTVGMMGY
PGTIGLPGPPGEPGSPGQKGSLVIPGMKCTRGPPGAKGXXXXXXXXXXXXXXXXXXXXXX
XXXXXFTGNPGEKGNRGTPGLPGLQGLPGPTGPPGPPGPRGDLGRTGNPGEAGPPGMAGG
MGNMGVPGSKGKQGTRGLPGLAGRPGLPGVPGLQGEKGEPGYSEGARPGPPGPTGDPGLP
GDMGKKGERGSPGPPGQAGPAGPEGAPGSPGVPGHPGKRGPDGKLGNKGVKGFRGPPGIK
GPPGLPGLPGSPGPVGMRGNQGRDGIPGPAGEKGETGLLGAYPGPRGNPGAQGAKGNKGA
PGWPGLPGQKGTMGDTGPRGPMGILGFPGPPGLPGAIIPGRKGNRGSPGSRGNPGEPGPP
GPPGSHIKGIKGDKGLMGQPGPKGLPGPVGDVGPPGHPGAPGDPGLPGPRGDPGFPGFPG
MRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPGFDGLPGLKGKLGDMG
PPATGTTMTGFVFTRHSQTVVPPPCPEGTQPLYSGFSLLFVQGNERAHGQDLGTLGSCLQ
RFTPMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPITGRALEPYISRCTVCEGPA
VAIAVHSQTTTIPPCPHGWISLWKGFSFLMFTSAGSEGAGQELASPGSCLEKFRASPFLE
CHGRGTCNYYSNSYSFWLASLDPERMFRKPTPSTVKAGELERIISRCQVCMKKRH
Download sequence
Identical sequences ENSDORP00000013109 ENSDORP00000013109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]