SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013120 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013120
Domain Number 1 Region: 196-383
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.49e-52
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 404-479
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.36e-21
Family Blood coagulation inhibitor (disintegrin) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013120   Gene: ENSDORG00000013956   Transcript: ENSDORT00000013956
Sequence length 709
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_26778:7901:10132:-1 gene:ENSDORG00000013956 transcript:ENSDORT00000013956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKTGAPLRVTLVLLWLAVVLSPSSLFQAGATQYPSSPEVVIPLKVTSRDRSTETPGWLSY
SLSGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCYYHGVMASESLVFSI
CFGGRGLQISGIYEIELIKHSTAFEHLVYRLYGNETQFSPMRCGLTEKAVAHQHLGFEGA
ENSGLKQNSSGDWWTHTWFLELAVVTDHDFFIYSQSNLSKVQEDVFLVVNIVDSVYHQLD
TYVTLIGIVIWNQGNVFPMTDINQVLEDFTQWKQVSLSQLQHDAAHIFIKSSIDVLGLAY
VAGICRPPLNCGVDNFQGDPWSLFANTVAHELGHTFGMQHDEKFCSCGEKGCIMSTFRVP
ADRFTNCSYDTFKKTILSQGSCLHSHPRPGGIFWLKRCGNGVIERGEECDCGSMQQCKQD
PCCRLNCTLKPGATCAFGLCCKACKFMPLGELCRQQANECDLPEWCNGTSHQCPEDGYVQ
DGIPCSATAYCYQKQCNTHDQQCREIFGKGAKSASQNCYKEINSQGSQIGHCGINGTVYL
KCNTSDILCGKVQCDNVEDVPQLQDHSVLQQTHINGVTCWGTKHHFGWGIPNFGEVKDGT
SCGAGKICIHKKCVSLSVLSQACLPETCNMNGICNNKHHCHCSYGWSPPHCLNRGYGGSD
DSGPASKRRVFLSGTGFLWGSSLICLMTVGICIYYQIRSRSRTKSHSST
Download sequence
Identical sequences ENSDORP00000013120 ENSDORP00000013120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]