SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013122 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013122
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily TIMP-like 2.04e-35
Family Netrin-like domain (NTR/C345C module) 0.00015
Further Details:      
 
Domain Number 2 Region: 90-203
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-20
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013122   Gene: ENSDORG00000013959   Transcript: ENSDORT00000013959
Sequence length 351
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3646:37333:47735:-1 gene:ENSDORG00000013959 transcript:ENSDORT00000013959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSGNKMMV
QMISDANTAGNGFMAMFSAAQPNERGDLYCGGRLEKPSGSFKTPNWPDRDYPAGVTCVWH
ILAPKNKLIELKFEKFDLERDNYCRYDYVAVFNGGEVNDANRIGKFCGDSPPAPIVSEKN
ELLIQFLSDLSLTADGFIGHYKFRPKKLPTTPAPPATTAYPVTVGLKPTVALCQQKCRRS
GTLESNYCSSNFVLTGTVITTVTRGASLHATVSIINIYKEGNLPIQQAGKNMSAKVVVVC
KQCPLLRRGLNYIIMGQVGEDGQGKVMPNSFIMMFKTKNQKVLTALENKRC
Download sequence
Identical sequences ENSDORP00000013122 ENSDORP00000013122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]