SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013132 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013132
Domain Number 1 Region: 10-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-83
Family Eukaryotic proteases 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013132   Gene: ENSDORG00000013970   Transcript: ENSDORT00000013969
Sequence length 258
Comment pep:novel scaffold:dipOrd1:scaffold_42461:4723:7539:1 gene:ENSDORG00000013970 transcript:ENSDORT00000013969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLWLLGCWAVLGAAFGCGIPAIPPEVSGLSRVVNGEDAVPGSWPWQVSLQYEGFHFCG
GALISEEWVVTAAHCGVTTDDKVVAGAFNLDPDEEGVQVLDIAEVFPNENYFISGTYDIA
LLKLATPARFTDTVSAVCLACNEADFPPGTPCVITGWGQTQYDKSTTLQQAVLPLVSTPV
CKEIWGDLVTDDMICAGSDGTSPCMGDSGGPLVCEKGGVWTQVGIVSWGSGFCPGDTPAV
FTRITAVLDWVKQILKEN
Download sequence
Identical sequences ENSDORP00000013132 ENSDORP00000013132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]