SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013180 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013180
Domain Number 1 Region: 312-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-46
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 8-84
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-19
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 89-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000128
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013180   Gene: ENSDORG00000014020   Transcript: ENSDORT00000014020
Sequence length 485
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6618:42598:53086:-1 gene:ENSDORG00000014020 transcript:ENSDORT00000014020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAASVTSLVDEVNCPICQGTLKEPVTIDCGHNFCRGCLTRYCEIPAPESEESLTCPLC
KEPFRPGGFRPNWQLANVVENIEHLQLVSTLGPGDEDICSEHREKVYFFCEDDEAHLCVV
CREAGEHGTHTVRFLEDAAGPYRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQVAT
KRQQVISEFAHLSRFLEEQQGILLTQLERLDGDILKQQEELEFLVSREICRFSALIEELE
EKNERPARELLTDIRSTLIRCETRKCRKPEAVSPELGQRIRDFPQQALPLQREMKKFLEM
LTPLLKTTVFPRTAHISLDPQTSHPKLLLSENHRRARFSYKWQNSPDNPQRFDRATCVLA
HSGFTGGRHSWVVGVDLTHGGSCTLGVVSEEVRRKGELRLRPEEGVWAIRLAWGFISALG
SFPTRLALEKQPRKVRVSLDYEVGWVTFANAITQEHIYTFTASFTRGVFPFFGLWGRGSS
FSLDC
Download sequence
Identical sequences ENSDORP00000013180 ENSDORP00000013180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]