SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013182 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013182
Domain Number 1 Region: 435-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-25
Family SPRY domain 0.00086
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 4.91e-21
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 305-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-19
Family SPRY domain 0.0029
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000133
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013182
Domain Number - Region: 379-423
Classification Level Classification E-value
Superfamily ARM repeat 0.00322
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013182   Gene: ENSDORG00000014023   Transcript: ENSDORT00000014022
Sequence length 538
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6618:69575:76600:-1 gene:ENSDORG00000014023 transcript:ENSDORT00000014022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPVSGNRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEASREQQDVKLCERHHEKLHYYCEDDGKLL
CVMCRESREHRPHTAVLVEKAALPQREKILNHLSILRRDRDKIQGFQAKGEADILAALKK
LQEQRQYIVAEFKQGHQFLKKREQHLLDQLATLEQLLTEGREKKTRGVGELARLTVVISE
LEGKARQPAAELMLDTRDFVNRYPRKKFWIGKPIPHMVKRKTGEFSDKLLSLQRGLTQFQ
GKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYQGSSLYPQQFDCEPGVLGSK
GFTWGKVYWEVEVEREGWSEDEDDGEEEEQGEEEEEEEEAGYEDGYDEWETDEDEESLGD
EEEEEEEEEEEVLESCMVGVARDTVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAQLF
PALRPRRVGIALDYEGGTVTFTNAESQELIYTFTTTFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences ENSDORP00000013182 ENSDORP00000013182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]