SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013206 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013206
Domain Number 1 Region: 1464-1574
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.15e-22
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013206   Gene: ENSDORG00000014047   Transcript: ENSDORT00000014046
Sequence length 1759
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5917:3502:32234:-1 gene:ENSDORG00000014047 transcript:ENSDORT00000014046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSATPLYGNVHSWMNSERVRMCGTSEDRKIPVNDGDTSKTRLELREENPLNHNVXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSSVVDVDASKADHMKKMAPTVLVHSRAASGLVLSGSE
IPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSLSLKNKTLDWAIPQQRS
SSCPRMGGTDAVVTNVSGSVSSAGRPASASPAPNANADGTKTNRSTMDTTPSVIQHVGQP
PTTPAKHNGSTSSKGAKASNPEPSFKTNENGLPPSSLFLSPNEAFRSPPIPYPRSYLPYP
APEGIAISPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDALG
LGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEEASLRNRFSEMLEASSTKLHPEVPT
DKNLKPTPSWNQGKTVVKSDKLVYVDLLREESDAKTANVSKPGFAAESVGQSTEPAKPPA
DLPLQQHRDFISLREELGRIGDFHEAYPFKQATGQPVFSLGKDNVPPTTNKENLGVPVAT
PFLEPTLGSESPAVTFGKAPEDPKPFCVGGGAPASVDVTPTYTKDGAEEADPNDGKVLKP
KPSKLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCE
RAMMRFSELEMKEREGGHPATKDSEVCKFSPADWERLKGNQDKKPKSVALEEAIADQNDS
ERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDWPEREMTNSSSNHLEDPHYSELTNLKVC
IELTGLHPKKQRHLLHLRERWEQQVSAAESKPGRQSRKEVTQAVQPEVTAQGNNLTEEKP
GRKRAEAKGNRGWSEESLKASDNDQGLPVFSGSPPIXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKHLVPQESRRGL
PITGEYYVENTDGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQATQLPRS
NSPQEATQSRPMPPEARRLIVNKNAGETLLQRAARLGYEXXXXXXXXXXXTDCDVNHRDN
AGYCAHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADP
TLATYSGRTIMKMTHSELMEKFLTDYLNDLQGQTEDDSSGAWEFYGSSVCEPDDESGYDV
LANPPGPEDPDDDDDSYSDMFEFEFSESPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMS
SRIFRCNFPSMEIVTIAEAEFYRQVSTSLLFSCSKDLEAFNPESKELLDLVEFTNELQTL
LGSTMEWLHPNGSTSEDYW
Download sequence
Identical sequences ENSDORP00000013206 ENSDORP00000013206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]