SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013233 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013233
Domain Number 1 Region: 444-606
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-34
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 50-152
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-23
Family Anticodon-binding domain 0.00035
Further Details:      
 
Domain Number 3 Region: 402-463
Classification Level Classification E-value
Superfamily GAD domain-like 0.000000000153
Family GAD domain 0.0094
Further Details:      
 
Domain Number 4 Region: 152-204
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000608
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013233   Gene: ENSDORG00000014074   Transcript: ENSDORT00000014074
Sequence length 645
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_635:51253:72388:1 gene:ENSDORG00000014074 transcript:ENSDORT00000014074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLGAWLGPLCRGLRRPVGRTPQLVRGALSRRLVLSSRRRIPEFNSFVSRTNTCGELRSS
HLGQEVTLCGWIQYRRQNIFLVLRDFHGLVQVIIPQDESSASVKKILCEAPLESVVKVSG
TVISRPPGQENPTMPTGEIEIKVKTAELLNACKKLPFEMKDFVKKTEALRLQYRYLDLRS
SQMQYNLRLRSEVVMKMREYLCNLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVLPIFLKASRNWNSPVAKLVTE
DQRLELIRLMEIQEEDVVLLTAGEHKKTCSLLGKLRLQCADLLETKGMVLRDPAQFSFLW
VVDFPLFLPKEESPTELESAHHPFTAPHPSDLHLLYTEPEKVRSQHYDLVLNGSEIGGGS
IRIHDAQLQQYILATLLKEDVKLLSHLLQALDHGAPPHGGIALGLDRLMCLITGAPSIRD
VIAFPKSFRGHDLMSSAPDSVPVEELRPYHIQVSWPTEAEAKRIH
Download sequence
Identical sequences ENSDORP00000013233 ENSDORP00000013233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]