SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013312 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013312
Domain Number 1 Region: 276-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-67
Family SPRY domain 0.00000976
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 9.66e-20
Family RING finger domain, C3HC4 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013312   Gene: ENSDORG00000014160   Transcript: ENSDORT00000014160
Sequence length 467
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5966:12984:20368:1 gene:ENSDORG00000014160 transcript:ENSDORT00000014160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTIDLMENLREELTCFICLDYFSSPVTTECGHSFCLRCLLKNWEEHNTPLSCPECWRTL
GGPHFQANERLGRLASIGRQLRSQVLLNEEEPSGGGKMASATVFSDDEQSVIAFSTPSHG
INRGYLSSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEETKTFKQVVVSE
YMKMHQFLKEEEQLQLQLLEKKEKENMKKLKENEIQLTQQVRNLSKMIGHIESTCQNSTL
ESFEEIREALERSETLLLQCPEATITELSLCHITGMRAMLRKFSTDITLDPATANAYLVL
SEDLKSVKYGGIRQQLPDNPERFDQSATVLGAQIFTCGRHYWEVEVGNKTEWEVGICKDS
VSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVHRVGVFLDYESGHIAFY
NVTDESLIYSFPSASFHEALRPIFSPCLPNEGSNIDPLTICSLNSHI
Download sequence
Identical sequences ENSDORP00000013312 ENSDORP00000013312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]