SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013342 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013342
Domain Number 1 Region: 7-230
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-90
Family Eukaryotic proteases 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013342   Gene: ENSDORG00000019764   Transcript: ENSDORT00000014191
Sequence length 232
Comment pep:novel scaffold:dipOrd1:scaffold_48447:4941:7232:-1 gene:ENSDORG00000019764 transcript:ENSDORT00000014191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFPLDDDDKIVGGYTCAPNSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLG
EHNINVQEGSEQIVRAAKAIRHPGYNSRNLDNDIMLIKLSSPVSLNSQVAPVALPTSCAP
AGTQCLISGWGNTLSFGVNNPDELQCLDAPLLSQSVCEAAYPGKVTKNMVCAGFIEGGKD
SCQGDSGGPVVCNGELQGIVSWGYGCALKDNPGVYTRVCNYVDWIQATIAAN
Download sequence
Identical sequences ENSDORP00000013342 ENSDORP00000013342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]