SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013346 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013346
Domain Number 1 Region: 404-471
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 546-675
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 670-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 4 Region: 1177-1233
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000103
Family TB module/8-cys domain 0.00034
Further Details:      
 
Domain Number 5 Region: 802-923
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 1533-1618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 357-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000371
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 927-1049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000105
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 1046-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000301
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 290-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000889
Family TB module/8-cys domain 0.0033
Further Details:      
 
Domain Number 11 Region: 159-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000188
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013346
Domain Number - Region: 1093-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013346   Gene: ENSDORG00000014195   Transcript: ENSDORT00000014195
Sequence length 1623
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4436:77309:105938:1 gene:ENSDORG00000014195 transcript:ENSDORT00000014195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQLGRRSRHPLLTLILLMLAAAAHPSPDPSPGPSPAMEVAEDLGRQAGIASCRCCVDQA
PRRSRCTRASCRVRSCPPEECTGLRQCPTLVPPVPSPSPSPSPSESKRQVSLNWQPLTLQ
EARALLIRRRLGRPGGRALLKNRPPQRAPLSQALVLCPLICHNGGVCVKPDRCLCPPDFA
GKFCQLHASGARPPAPAMPGITRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQ
VERVSGPWEEADPEAVARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRRG
ECVSPLPGLRTQEVCCRGEGVAWGVHDCQPCSEHLGNRVGGADGPCPTGFERVNGSCVDV
DECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGC
SLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRP
LAQEPPRVSLSQPRAPAATSRPPTGFLPTHRPEPRPEPRPEPRPGPEFPLPSIPAWTGPE
IPEPSSGVCQRNPQVCGPGRCISRPGGHTCACDSGFRLSPQGTRCVDLDECRRVPSPCAP
GRCENTPGSFRCVCGPGFRASPRATECLDVDECRRVPPPCDRGRCENTPGSFLCVCPAGY
QAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVCPAGFRGSTCEEDVDECAQEPPP
CGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPSPCAYGRCENTEGSFQCVCP
TGFQPNAAGSECKDVDECENHLACPGQECVNSPGSFQCRACPAGHHLHRGRCTDVDECSS
GAPCGLHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADINECLEGDFCFPHGECLNTDGSF
ACTCAPGYRPGPRGASCLDVDECSEEDLCQSGVCTNTDGSFECICPPGHRTGPDLASCLD
IDECREQGSALCGSQRCENSPGSYRCVQDCDPGYHAGPEGTCDDVDECQEYGSAICGAQR
CENTPGSYRCVPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYE
GARDGRHCVDVNECATLQGVCGTALCENVEGSFLCVCPSSPEEFDPMTGRCVPPRTSAGT
FPGSQPQAPASPSLPARPPPPSAPRRPSPPRQGPVGSERRECYFDTAAPDACDNILARNV
TWQECCCTVGEGWGSGCRIQQCPGTDTAEYQSLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXDFEALCNVLRPPAYGPPRPGGFGLPYEYGPDIGPPYQGLPYGPEL
YPPPVLPYDPYPPPPGPFARREAPYGAPPFDMPDFEDDGGPYSDSEAPEPPGRGAGWSYR
SRDTRGSFPEPEESSEAGGYTGALSERYEGLEAEDCGILDGCAHGRCVRVPEGFTCDCFD
GYRLDITRMACLDINECDEMEAASPLCVNARCVNTDGSFRCVCRPGFAPTHQPHHCAPAR
PRA
Download sequence
Identical sequences ENSDORP00000013346 ENSDORP00000013346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]