SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013377 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013377
Domain Number 1 Region: 117-244
Classification Level Classification E-value
Superfamily PUG domain-like 3.4e-29
Family PUG domain 0.0025
Further Details:      
 
Domain Number 2 Region: 275-378
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000448
Family UBX domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013377   Gene: ENSDORG00000014226   Transcript: ENSDORT00000014226
Sequence length 412
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5061:31231:36769:-1 gene:ENSDORG00000014226 transcript:ENSDORT00000014226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKAPKESQQPALRQPRQGPTDEAQMAAAAALARLEQKQPRSRGRTSQDSIRNQVRKELQA
EATSSSSPDAPGTKSMPETKEEGSGHLAVNGVYFTCPLTGATLRRDQRDARIREAIMSHF
TTDPVAASIMKIHTFNRDRDRVKLGVDTIAKYLDNIHLHPEEEKYRKIKLQNKVFQERIN
CLEGTHEFLEAIGFQRVLLPVADQEAAEEFYVLSEAALAQPESLERHKERLVGAEPVRAQ
LDRQRRVFRPSARAAQFDLPADFFNLSAEELKREQRLRSEAVERLSTLRTKAMREKEEQR
ELRKYTYTLLRVRLPDGCLLQXXXXXXXXXXXXXXXVRESLQSDWLPFELLASGEHKLEE
ENQAFNECELVPSALLTFAWDAAVLEDIRAAGTELDSSVLKPELLEAMEKLS
Download sequence
Identical sequences ENSDORP00000013377 ENSDORP00000013377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]