SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013393 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013393
Domain Number 1 Region: 482-512,548-616
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013393   Gene: ENSDORG00000014243   Transcript: ENSDORT00000014242
Sequence length 645
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6751:58113:175476:1 gene:ENSDORG00000014243 transcript:ENSDORT00000014242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTPPCEDIKYWCRKRLPILEWAPHYNLKENVLPDIVSGVMSAVQHVTQGLAFAILSSVH
PVFGLYGSLFPAIIYAIFGMGRHVATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVAMFVLQLGSATFLVTEPVISAMTTGAATHVVTSQV
KYLLGIKMPYISGPLGFFYIYAYVFENIKSVRLEAVLLSSLSIVVLVLVKELNEQFKRKI
KVVLPIDLVLIIAATFACYFTNMESAYGLEVIGHIPKGIPPPQAPSMGILSAVVTEAFGV
ALVGYVASLALAQGSAKKFKYSVDDNQELLAHGLSNVISSFCFCIPSAAAMGRTAGLYST
GSKTQVACLISCIFVLIVIYAIGPLLYWLPMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGIWISTYIFTICFAANVGLLFGVVSTIAIVIGRFPREKTLSIINMKEMEFKVKTETD
DETLQQVKIISINNPLVFLNAKKFGADVMNLVQKENQLLDDISKCEQNTLLNSLSNGNCN
DELAQPCSSEKCSLVLDCTGLTFFDYSGVSMLVEVYMNCKGRNVDVSLASCTASLIKAMT
YCGNLDSEKPIFFDSVSAAISNIYSNKASYEVLNNLAVLTRSLLR
Download sequence
Identical sequences ENSDORP00000013393 ENSDORP00000013393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]