SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013418 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013418
Domain Number 1 Region: 251-433
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.27e-28
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.0000000794
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013418
Domain Number - Region: 445-477
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00103
Family Blood coagulation inhibitor (disintegrin) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013418   Gene: ENSDORG00000014267   Transcript: ENSDORT00000014267
Sequence length 784
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4768:220334:289750:-1 gene:ENSDORG00000014267 transcript:ENSDORT00000014267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLDSLLSDYDILSLSNIQQHSVRKRGLQASTHLETLLTFSALKRHFKLYTSSTERFSRNF
KVVVIDGKDEREYNVKWQDFFSGHVVGEPDSKVLAHIGDDDITIRIYTDGAEYNIEPLWR
FVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYVNVDKEELIPKGLIDREPPQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXIRILKSPQEVKPGEKHYNMAKSYPQEDKDAWDVKMLLEQFSFDIAEEASKVCL
AHLFTYQDFDMGTLGLAYVGSPKANSHGGVCPKAYYSPVGRKNIYLNSGLTSTKNYGKTI
LTKEADLVTTHFGHFGAHDPDGLAECAPSDQREYVXXXXXXXXXXXXXXMFSNCSKQSIY
KTIESKAQECFQERSNKVCGNSRVDEGEECDPGIMHLNNDTCCNSDCTLKPGVQCXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
KCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPAPQTPGRLQPAMLPPAPAAPRLDHQRMD
TIQEDPSTDSHVDEDGFEKDPFPNSSTAAKSFEDLTGHPVTRSEKAASFKLQRQSRVDSK
ETEC
Download sequence
Identical sequences ENSDORP00000013418 ENSDORP00000013418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]