SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013462 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013462
Domain Number 1 Region: 106-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-29
Family SPRY domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013462   Gene: ENSDORG00000014312   Transcript: ENSDORT00000014312
Sequence length 243
Comment pep:novel scaffold:dipOrd1:scaffold_85238:3574:4339:-1 gene:ENSDORG00000014312 transcript:ENSDORT00000014312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGVQEEERHHSQLLINEGRAMLLQLRERETQMLQKKHQLRNMYQKLIETYQKPDVDLLQE
SVLFFLPLPLRPELSVPPIPGLIERLSQYQVEIAFNEAGIKILGAVWTQQYAVLNSEESF
HFTAFGRKVFSSGKHYWEVSVDDSSTWALGVTRHSSIESNLTESEDLFLLLFVKENTLST
IFTTSPLLPHYVEKPLGRVGVFLDLDDGSVSFWNVAKSSLIWRYPTGAIQFPVRPHFFSG
SRC
Download sequence
Identical sequences ENSDORP00000013462 ENSDORP00000013462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]