SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013463 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013463
Domain Number 1 Region: 12-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.12e-31
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 327-375
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000353
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013463   Gene: ENSDORG00000014313   Transcript: ENSDORT00000014313
Sequence length 383
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_28015:4337:6913:1 gene:ENSDORG00000014313 transcript:ENSDORT00000014313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSYAASEESRILVLTELLEKKAHSPFYQEGVSNALLKMAELGLMRAADVLLRNGANLNFE
DPVTYYTALHIAVLRNQPDMVELLVRHGADINRRDRIHESSPLDLASEEPERLPCLRRLL
ELGADVNAADKHGKTALLHALASSDGVQVHNTDNIRLLLEGGADVKATTKDGDTVFTCII
FLLGETVGGDKDEVRLINRFCLQVTQLLLAHGADPSECPAHESLTYICLKSFRLHLPLLR
FLLESGAAYNCSLHGAGCWSGFHLVFERLCAPLGCAEEESCGELLRKAETVLDLMVTNSP
KLRLPASFDIHPVGSLAGQVQALHASLRQLERHPPPLKHLCRVSIRLHLQPWPVDTKVKA
LPLPDRLKWYLLSAHSGAGEDDS
Download sequence
Identical sequences ENSDORP00000013463 ENSDORP00000013463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]