SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013483 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013483
Domain Number 1 Region: 97-382
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.22e-53
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000248
Further Details:      
 
Domain Number 2 Region: 394-534
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.11e-24
Family Ricin B-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013483   Gene: ENSDORG00000014336   Transcript: ENSDORT00000014336
Sequence length 537
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4320:55122:209557:-1 gene:ENSDORG00000014336 transcript:ENSDORT00000014336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLTRRLVLPIFGVLWITVLLFFWVTKRKLEVPLGPEVQTPKFGPLLLLEDGVSIWAFP
HPFHQLWRLPISPGHIARCLPLLNRAQLLLQPVFLEAICTLLMYCTDLPPTSIIITFHNE
ARSTLLRTIRSVLNRTPMHLIQEIILVDDFSNDPDDCKQLMKLPKVKCLRNSVRQGLVRS
RIRGADVAQGSTLTFLDSHCEVNRDWLQPLLHRVKEDYTKVVCPVIDIINLDTFNYIESA
SELRGGDWSLHRWEQLSPEQKRLDPTEPIRTPIIAGGLFVIDKAWFDYLGKYDTDMDIWG
GENFEISFRVWMCGGSLEIIPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEY
KQYYYAARPFALDRPFGNIRRQLRELPCRLKYLVYPELRVPSDSSIQKGNIRQRQKCLES
QKQNNEELPSLRLSPCIKSNEAKSQVWAFTYTQQIIQEELCLSVVTLFPGAPVVLTQCKN
GDDRQQWIRTGARIEHIASHLCLDTDMFGDSTEDGREVVVNPCESSLMSQHWDVVSS
Download sequence
Identical sequences ENSDORP00000013483 ENSDORP00000013483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]