SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013495 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013495
Domain Number 1 Region: 46-177
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-25
Family FAD-linked reductases, N-terminal domain 0.076
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013495
Domain Number - Region: 244-321
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000181
Family FAD-linked reductases, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013495   Gene: ENSDORG00000014350   Transcript: ENSDORT00000014349
Sequence length 395
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_831:2672:23939:-1 gene:ENSDORG00000014350 transcript:ENSDORT00000014349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVLRYLRGSCRQALGGFLGGFSGSASGRPRPLCGGSRRASTSSFDIVVVGGGIVGLAS
ARALALRHPQLKIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVKGSALIYEY
CKQKGIPYKQCGKLIVAVDQEEIPRLQALYERGLQNGVQGLRLIQQEDIKKKEPYCRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGEEIRCQYIVTCAGLYSDRISELSGCSPHPTIVPFRGDYLLLKPEKSYLVKGNIYPV
PDSRFPFLGIHFTPRMDGSIWLGPNAVLAFKREGYRFFDFSAKDFMEIIMNSGLIKLVFQ
NFSYSVNEMYKACFLAVTVKNLQKFVPEITIHDIQ
Download sequence
Identical sequences ENSDORP00000013495 ENSDORP00000013495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]