SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013527 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000013527
Domain Number - Region: 16-59
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0544
Family Family 6 carbohydrate binding module, CBM6 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013527   Gene: ENSDORG00000014385   Transcript: ENSDORT00000014384
Sequence length 101
Comment pep:novel scaffold:dipOrd1:scaffold_43914:10049:11390:1 gene:ENSDORG00000014385 transcript:ENSDORT00000014384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLGLFGLFIAPGLADYNINVNDDNNVSGSGQQRVSINNAHNVANIDNNNGWDSWNTIW
DYENSFAATRLFAKKSCIVHRMNKEVMPSIQTLDALVKEKK
Download sequence
Identical sequences ENSDORP00000013527 ENSDORP00000013527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]