SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013541 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013541
Domain Number 1 Region: 17-194
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-53
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013541   Gene: ENSDORG00000014400   Transcript: ENSDORT00000014400
Sequence length 194
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1317:4369:13122:-1 gene:ENSDORG00000014400 transcript:ENSDORT00000014400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGVPRLWVLLLLVLETAGVQASAGAWPWQVSLREYGQHVCGGSVISEDWVLTAAHCFNQ
PAPVRLVLLGSISSYPRPARRALRHPSYSDEEHSMGDIALLRLASPVSFSDLILPVCLPK
PGDPLDPGITCWVTGWGYLRLRPPFTLQEVELPLIARQTCEAYYQGNPESGQGSLILEDM
LCAGFEEGQKDSCY
Download sequence
Identical sequences ENSDORP00000013541 ENSDORP00000013541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]